The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for the recognition of the two NKG2A immunoreceptor tyrosine-based inhibitory motifs (ITIMs) by the C-terminal SH2 domain of protein tyrosine phosphatase SHP-1. To be Published
    Site RSGI
    PDB Id 2rmx Target Id hss001003119.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13316, Molecular Weight 11603.54 Da.
    Residues 105 Isoelectric Point 5.74
    Sequence wyhghmsggqaetllqakgepwtflvreslsqpgdfvlsvlsdqpkagpgsplrvthikvmceggrytv ggletfdsltdlvehfkktgieeasgafvylrqpyy
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch