.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rok

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The RRM domain of poly(A)-specific ribonuclease has a noncanonical binding site for mRNA cap analog recognition. Nucleic Acids Res. 36 4754-4767 2008
    Site RSGI
    PDB Id 2rok Target Id mmt007011199.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13529, Molecular Weight 10007.81 Da.
    Residues 87 Isoelectric Point 8.90
    Sequence gpdlqpkrdhvlhvtfpkewktsdlyqlfsafgniqiswiddtsafvslsqpeqvqiavntskyaesyr iqtyaeyvgkkqkgkqvk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands 7MG-GDP (7N-METHYL-8-HYDROGUANOSINE-5'-MONOPHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch