.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rpz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the monomeric form of mouse APOBEC2. To be Published
    Site RSGI
    PDB Id 2rpz Target Id mmk001001360.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS27325, Molecular Weight 24450.55 Da.
    Residues 211 Isoelectric Point 4.81
    Sequence msqngddlenledpeklkelidlppfeivtgvrlpvnffkfqfrnveyssgrnktflcyvvevqskggq aqatqgyledehagahaeeaffntilpafdpalkynvtwyvssspcaacadrilktlsktknlrllilv srlfmweepevqaalkklkeagcklrimkpqdfeyiwqnfveqeeseskafepwediqenflyyeekla dilk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch