.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rqc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for the sequence-specific RNA-recognition mechanism of human CUG-BP1 RRM3. Nucleic Acids Res. 37 5151-5166 2009
    Site RSGI
    PDB Id 2rqc Target Id hss001001546.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13263, Molecular Weight 11260.34 Da.
    Residues 102 Isoelectric Point 9.17
    Sequence ltqqsigaagsqkegpeganlfiyhlpqefgdqdllqmfmpfgnvvsakvfidkqtnlskcfgfvsydn pvsaqaaiqsmngfqigmkrlkvqlkrskndsk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch