.
The Open Protein Structure Annotation Network
PDB Keyword
.

2uxs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Rv3628: An Inorganic Pyrophosphatase from Mycobacterium Tuberculosis. To be Published
    Site RSGI
    PDB Id 2uxs Target Id ar_001000419.1
    Molecular Characteristics
    Source Mycobacterium tuberculosis
    Alias Ids TPS12156, Molecular Weight 18295.67 Da.
    Residues 162 Isoelectric Point 4.73
    Sequence vqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgddgdpldalvllpqpvfpg vlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdvpafeldaikhffvhykdlepgkfvkaa dwvdraeaeaevqrsverfkagth
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.70 Rfree 0.274
    Matthews' coefficent 2.2 Rfactor 0.232
    Waters 36 Solvent Content 50

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch