.
The Open Protein Structure Annotation Network
PDB Keyword
.

2uyg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystallogaphic Structure of the Typeii 3-Dehydroquinase from Thermus Thermophilus. To be Published
    Site RSGI
    PDB Id 2uyg Target Id ttk003000003.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14148, Molecular Weight 16452.99 Da.
    Residues 149 Isoelectric Point 5.17
    Sequence mvlilngpnlnllgrrepevygrttleelealceawgaelglgvvfrqtnyegqliewvqqahqegfla ivlnpgalthysyalldairaqplpvvevhltnlhareefrrhsvtapacrgivsgfgplsyklalvyl aetlevggegf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.20 Rfree 0.277
    Matthews' coefficent 2.7 Rfactor 0.230
    Waters 119 Solvent Content 54.1

    Ligand Information
    Ligands GOL (GLYCEROL) x 12
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch