.
The Open Protein Structure Annotation Network
PDB Keyword
.

2vrd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structure and Biochemical Properties of the Human Spliceosomal Protein U1C. J.Mol.Biol. 341 185 2004
    Site RSGI
    PDB Id 2vrd Target Id trt001000158.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14089, Molecular Weight 7265.83 Da.
    Residues 61 Isoelectric Point 8.46
    Sequence mpkfycdycdtylthdspsvrkthcsgrkhkenvkdyyqkwmeeqaqslidkttaafqqgk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch