The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Sure Protein from Aquifex Aeolicus Vf5 at 1.5 A Resolution. Acta Crystallogr.,Sect.F 65 1204-1208 2009
    Site RSGI
    PDB Id 2wqk Target Id aae001000832.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12046, Molecular Weight 28163.80 Da.
    Residues 251 Isoelectric Point 5.25
    Sequence mptfllvnddgyfspginalrealkslgrvvvvapdrnlsgvghsltfteplkmrkidtdfytvidgtp adcvhlgyrvileekkpdlvlsginegpnlgeditysgtvsgamegrilgipsiafsafgrenimfeei akvcvdivkkvlnegipedtylnvnipnlryeeikgikvtrqgkraykervfkyidpygkpfywiaaee fgwhaeegtdywavlngyvsvtplhldltnykvmksikyledsp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.19085
    Matthews' coefficent 2.59 Rfactor 0.15573
    Waters 605 Solvent Content 52.43

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals NA (SODIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch