The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second HMG-box domain from high mobility group protein B3. To be Published
    Site RSGI
    PDB Id 2yqi Target Id hso002002696.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13021, Molecular Weight 8351.15 Da.
    Residues 74 Isoelectric Point 9.55
    Sequence napkrppsgfflfcsefrpkikstnpgisigdvakklgemwnnlndsekqpyitkaaklkekyekdvad ykskg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch