The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the FYVE domain in zinc finger FYVE domain-containing protein 12. To be Published
    Site RSGI
    PDB Id 2yqm Target Id hsg002000371.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12332, Molecular Weight 9328.13 Da.
    Residues 82 Isoelectric Point 8.65
    Sequence ikevnqalkghawlkddeathcrqcekefsisrrkhhcrncghifcntcssnelalpsypkpvrvcdsc htlllqrcsstas
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch