The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures and evolutionary relationship of two different lipoamide dehydrogenase(E3s) from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2yqu Target Id ttk003000541.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14409, Molecular Weight 49055.19 Da.
    Residues 455 Isoelectric Point 6.73
    Sequence mydllvigagpggyvaairaaqlgmkvgvvekekalggtclrvgcipskalletteriyeakkgllgak vkgveldlpalmahkdkvvqantqgveflfkkngiarhqgtarflserkvlveetgeelearyiliatg saplippwaqvdyervvtstealsfpevpkrlivvgggviglelgvvwhrlgaevivleymdrilptmd levsraaervfkkqgltirtgvrvtavvpeakgarveleggevleadrvlvavgrrpyteglslenagl stdergripvdehlrtrvphiyaigdvvrgpmlahkaseegiaavehmvrgfghvdyqaipsvvythpe iaavgyteeelkaqgipykvgkfpysasgraramgetegfikvlahaktdrilgvhgigarvgdvlaea alalffkasaedlgraphahpslseilkeaalaawerpihl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.22988
    Matthews' coefficent 2.48 Rfactor 0.19504
    Waters 972 Solvent Content 50.46

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch