.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yqy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHA0303 (TT2238), a four-helix bundle protein with an exposed histidine triad from Thermus thermophilus HB8 at 2.0 A. Proteins 70 1103-1107 2008
    Site RSGI
    PDB Id 2yqy Target Id ttk003002238.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14828, Molecular Weight 18710.53 Da.
    Residues 169 Isoelectric Point 6.99
    Sequence mvrledygtwdealkrleasrkallallreadpawlsaplregawtplmvaehvalvedstarvlrrlr rlaagenlppvpvkpgefkdgkpqapegvrpkgglsleevlalldraraflleevakadpqnpatfphp ffgelnplgwlraaayheahhlkalqaslpr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.25738
    Matthews' coefficent 1.88 Rfactor 0.22032
    Waters 73 Solvent Content 34.49

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch