.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yqz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Hypothetical Methyltransferase TTHA0223 from Thermus thermophilus HB8 complexed with S-adenosylmethionine. To be published
    Site RSGI
    PDB Id 2yqz Target Id ttk003001374.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14708, Molecular Weight 29640.59 Da.
    Residues 263 Isoelectric Point 7.09
    Sequence mssallraayaydrlrahppevagqiatamasavhpkgeepvflelgvgtgrialpliargyryialda daamlevfrqkiagvdrkvqvvqadaraiplpdesvhgvivvhlwhlvpdwpkvlaeairvlkpggall egwdqaeaspewtlqerwrafaaeegfpverglhakrlkeveealrrlglkprtrevarwreertprea lealserlysftqglpepvharvmerlwawaeaelgdldrpfpvekrfllrvsrlg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.235
    Matthews' coefficent 2.28 Rfactor 0.202
    Waters 256 Solvent Content 46.11

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch