The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title hypothetical alanine aminotransferase (TTHA0173) from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2yri Target Id ttp001000173.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14832, Molecular Weight 37840.81 Da.
    Residues 353 Isoelectric Point 8.63
    Sequence mllltpgptpipervqkallrpmrghldpevlrvnraiqerlaalfdpgegalvaalagsgslgmeagl anldrgpvlvlvngafsqrvaemaalhgldpevldfppgepvdpeavaralkrrryrmvalvhgetstg vlnpaeaigalakeagalffldavttlgmlpfsmramgvdyaftgsqkclsappglapiaaslearkaf tgkrgwyldlarvaehwerggyhhttpvllhyallealdlvleegvaarerrarevyawvleelkargf rpypkasplptvlvvrppegvdadrlvralyaegvavaggigptrgqvlrlglmgegarreayqaflka ldralala
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.2404
    Matthews' coefficent 2.57 Rfactor 0.1914
    Waters 811 Solvent Content 52.12

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch