The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the zf-C2H2 domain in zinc finger homeodomain 4. To be Published
    Site RSGI
    PDB Id 2yrk Target Id ar_001000691.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS12209, Molecular Weight 5390.80 Da.
    Residues 48 Isoelectric Point 8.76
    Sequence gtdgtkpectlcgvkysarlsirdhifskqhiskvretvgsqldrekd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch