The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the tandem HMG box domain from Human High mobility group protein B1. To be Published
    Site RSGI
    PDB Id 2yrq Target Id hsb001016428.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12319, Molecular Weight 19109.09 Da.
    Residues 166 Isoelectric Point 9.74
    Sequence mgkgdpkkprgkmssyaffvqtcreehkkkhpdasvnfsefskkcserwktmsakekgkfedmakadka ryeremktyippkgetkkkfkdpnapkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaa ddkqpyekkaaklkekyekdiaayrakg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch