.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ys6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of GAR synthetase from Geobacillus kaustophilus. To be Published
    Site RSGI
    PDB Id 2ys6 Target Id gka001000268.3
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12293, Molecular Weight 48137.19 Da.
    Residues 451 Isoelectric Point 5.49
    Sequence mgsshhhhhhssgenlyfqghmnvlvigrggrehaiawkaaqsplvgklyvapgnpgiadvaelvhide ldiealvqfakqqaidltivgpeaplasgivdrfmaeglrifgpsqraaliegskafakelmkkygipt adhaaftsyeeakayieqkgapivikadglaagkgvtvaqtveealaaakaalvdgqfgtagsqvviee ylegeefsfmafvngekvyplaiaqdhkraydgdegpntggmgayspvpqisdemmdaaleailrpaak alaaegrpflgvlyaglmatangpkviefnarfgdpeaqvvlprlktdlveavlavmdgkelelewtde avlgvvlaakgypgayergaeirgldrispdallfhagtkreggawytnggrvlllaakgetlakakek ayeqlaaidcdglfyrrdigrraierasaaytrmkgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.21 Rfree 0.23
    Matthews' coefficent 2.12 Rfactor 0.204
    Waters 82 Solvent Content 42.00

    Ligand Information
    Ligands GLY (ADENOSINE) x 1;AMP x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch