The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of GAR synthetase from Geobacillus kaustophilus. To be Published
    Site RSGI
    PDB Id 2ys7 Target Id gka001000268.4
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12294, Molecular Weight 45925.95 Da.
    Residues 432 Isoelectric Point 5.21
    Sequence ghmnvlvigrggrehaiawkaaqsplvgklyvapgnpgiadvaelvhideldiealvqfakqqaidlti vgpeaplasgivdrfmaeglrifgpsqraaliegskafakelmkkygiptadhaaftsyeeakayieqk gapivikadglaagkgvtvaqtveealaaakaalvdgqfgtagsqvvieeylegeefsfmafvngekvy plaiaqdhkraydgdegpntggmgayspvpqisdemmdaaleailrpaakalaaegrpflgvlyaglma tangpkviefnarfgdpeaqvvlprlktdlveavlavmdgkelelewtdeavlgvvlaakgypgayerg aeirgldrispdallfhagtkreggawytnggrvlllaakgetlakakekayeqlaaidcdglfyrrdi grraierasaaytrmkgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.21 Rfree 0.251
    Matthews' coefficent 2.10 Rfactor 0.208
    Waters 160 Solvent Content 41.46

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch