.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ys9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title structure of the third Homeodomain from the human homeobox and leucine zipper protein, Homez. To be Published
    Site RSGI
    PDB Id 2ys9 Target Id hsk002101415.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12765, Molecular Weight 6568.06 Da.
    Residues 57 Isoelectric Point 4.65
    Sequence plpipppppdiqplerywaahqqlretdipqlsqasrlstqqvldwfdsrlpqpaev
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch