The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the WW domain from the human amyloid beta A4 precursor protein-binding family B member 3, APBB3. To be Published
    Site RSGI
    PDB Id 2ysc Target Id hsk003002479.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12870, Molecular Weight 3737.00 Da.
    Residues 32 Isoelectric Point 9.70
    Sequence glppgwrkihdaagtyywhvpsgstqwqrptw
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch