The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first WW domain from the mouse transcription elongation regulator 1, transcription factor CA150. To be Published
    Site RSGI
    PDB Id 2ysi Target Id mmt010017959.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13665, Molecular Weight 3904.09 Da.
    Residues 33 Isoelectric Point 5.05
    Sequence teeiwvenktpdgkvyyynartresawtkpdgv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch