The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein TTHA1432 from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2ysk Target Id ttk003001747.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS23814, Molecular Weight 16254.89 Da.
    Residues 145 Isoelectric Point 6.07
    Sequence msatglevfdrtlhkthawlkaimeelgtedrhkaylalravlhalrdrltveevaqlaaqlpmlvrgl yyegwdptgkplkerhkeaflahvaeelktpsgpavdpeaatravfkvlsreisqgeledvlgllpkel ralwpqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.241
    Matthews' coefficent 2.04 Rfactor 0.206
    Waters 141 Solvent Content 39.85

    Ligand Information
    Ligands SO4 (SULFATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch