The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the DEP domain from human DEP domain-containing protein 1. To be Published
    Site RSGI
    PDB Id 2ysr Target Id hss001104035.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13365, Molecular Weight 11643.64 Da.
    Residues 98 Isoelectric Point 9.84
    Sequence yratklwnevttsfragmplrkhrqhfkkygncftageavdwlydllrnnsnfgpevtrqqtiqllrkf lknhviedikgrwgsenvddnnqlfrfpa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch