The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode. J.Biol.Chem. 283 27165-27178 2008
    Site RSGI
    PDB Id 2yt0 Target Id tkr001324504.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS14068, Molecular Weight 18628.88 Da.
    Residues 169 Isoelectric Point 4.76
    Sequence daavtpeerhlskmqqngyenptykffeqmqnsgssgssgssgssgptpktelvqkfrvqylgmlpvdr pvgmdtlnsaienlmtssskedwpsvnmnvadatvtvisekneeevlvecrvrflsfmgvgkdvhtfaf imdtgnqrfechvfwcepnaanvseavqaac
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch