The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the PDZ domain of Amyloid beta A4 precursor protein-binding family A member 3 (Neuron- specific X11L2 protein) (Neuronal Munc18-1-interacting protein 3) (Mint-3) (Adapter protein X11gamma). To be Published
    Site RSGI
    PDB Id 2yt8 Target Id ar_001000806.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12220, Molecular Weight 9466.49 Da.
    Residues 87 Isoelectric Point 8.06
    Sequence vttaiihrphareqlgfcvedgiicsllrggiaerggirvghriieingqsvvatphariiellteayg evhiktmpaatyrlltgq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch