The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of C2H2 type Zinc finger domain 345 in Zinc finger protein 278. To be Published
    Site RSGI
    PDB Id 2yt9 Target Id hsi002013231.5
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12493, Molecular Weight 9393.37 Da.
    Residues 82 Isoelectric Point 9.57
    Sequence vaceicgkifrdvyhlnrhklshsgekpyscpvcglrfkrkdrmsyhvrshdgsvgkpyicqscgkgfs rpdhlnghikqvh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch