.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ytc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RNA binding domain in Pre-mRNA-splicing factor RBM22. To be Published
    Site RSGI
    PDB Id 2ytc Target Id hss001002688.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13302, Molecular Weight 8933.72 Da.
    Residues 78 Isoelectric Point 9.43
    Sequence edktittlyvgglgdtitetdlrnhfyqfgeirtitvvqrqqcafiqfatrqaaevaaeksfnklivng rrlnvkwgr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch