.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yty

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein. J.Struct.Funct.Genom. 11 181-188 2010
    Site RSGI
    PDB Id 2yty Target Id hsk002000864.5
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12617, Molecular Weight 8416.98 Da.
    Residues 75 Isoelectric Point 6.94
    Sequence rllgrnsnskrllgyvatlkdnfgfietanhdkeiffhysefsgdvdslelgdmveyslskgkgnkvsa ekvnkt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch