.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yu0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the PAAD_DAPIN domain of mus musculus interferon-activatable protein 205. To be Published
    Site RSGI
    PDB Id 2yu0 Target Id mmt008008361.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13662, Molecular Weight 9485.49 Da.
    Residues 81 Isoelectric Point 5.90
    Sequence ivllrglecinkhyfslfksllardlnlerdnqeqyttiqianmmeekfpadsglgkliefceevpalr kraeilkkerse
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch