The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the domain swapped WingedHelix in DNA-directed RNA polymerase III 39 kDa polypeptide. To be Published
    Site RSGI
    PDB Id 2yu3 Target Id hss001003795.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13342, Molecular Weight 9288.28 Da.
    Residues 82 Isoelectric Point 9.82
    Sequence gqldllrsntgllyrikdsqnagkmkgsdnqeklvyqiiedagnkgiwsrdvryksnlplteinkilkn leskklikavksv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch