The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the DnaJ domain from human Williams-Beuren syndrome chromosome region 18 protein. To be Published
    Site RSGI
    PDB Id 2yua Target Id hsi002006527.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12414, Molecular Weight 9525.02 Da.
    Residues 86 Isoelectric Point 8.66
    Sequence sqgdcsysrtalydllgvpstatqaqikaayyrqcflyhpdrnsgsaeaaerftrisqayvvlgsatlr rkydrgllsdedlrgpg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch