The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and functional characterization of the NHR1 domain of the Drosophila neuralized E3 ligase in the notch signaling pathway. J.Mol.Biol. 393 478-495 2009
    Site RSGI
    PDB Id 2yue Target Id my_001000056.1
    Molecular Characteristics
    Source Drosophila melanogaster
    Alias Ids TPS13737, Molecular Weight 18399.85 Da.
    Residues 161 Isoelectric Point 6.37
    Sequence plqfhsvhgdnirisrdgtlarrfesfcraitfsarpvrinericvkfaeisnnwnggirfgftsndpv tlegtlpkyacpdltnrpgfwakalheqycekdnilyyyvngagdviyginneekgviltgidtrsllw tvidiygnctgiefldsriymyq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch