.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yut

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Short-Chain Oxidoreductase TTHB094 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2yut Target Id ttk003001258.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14674, Molecular Weight 21660.00 Da.
    Residues 207 Isoelectric Point 9.25
    Sequence mrvlitgatgglggafaralkghdlllsgrragalaelarevgaralpadladeleakalleeagpldl lvhavgkagrasvreagrdlveemlaahlltaafvlkharfqkgaravffgaypryvqvpgfaayaaak galeayleaarkellregvhlvlvrlpavatglwaplggppkgalspeeaarkvleglfrepvpallev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.224
    Matthews' coefficent 3.51 Rfactor 0.19
    Waters 119 Solvent Content 64.98

    Ligand Information
    Ligands NAP (NADP) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch