.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yv4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of C-terminal Sua5 Domain from Pyrococcus horikoshii Hypothetical Sua5 Protein PH0435. To be Published
    Site RSGI
    PDB Id 2yv4 Target Id pho001000435.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13819, Molecular Weight 37085.27 Da.
    Residues 340 Isoelectric Point 8.85
    Sequence mtiiinmrsgvdevklriaakliregklvafptetvyglgadalneravrrifeakgrpadnplilhia kfsqvyelarevpeeakvlverfwpgpltivlprkdvvpdvttggldtvairmpaneialklielsgkp iaapsanisgkpsptsaehvaddfygkieciidggetrigvestvidltehppvllrpgglpleeiekv igkvrihpavfgkkvdtpkspgmkykhyapnaevivvegprekvkgkitelvkelkergkkvgvigses ynadeffflgssveevaknlfkalrymdkagvdvviaegveerglglavmnrlrkasgykivka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.253
    Matthews' coefficent 2.21 Rfactor 0.206
    Waters 84 Solvent Content 44.38

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch