.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yv8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of N-terminal domain of human galectin-8. To be Published
    Site RSGI
    PDB Id 2yv8 Target Id hso002002300.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13005, Molecular Weight 17040.89 Da.
    Residues 151 Isoelectric Point 8.44
    Sequence mmlslnnlqniiynpvipyvgtipdqldpgtlivicghvpsdadrfqvdlqngssvkpradvafhfnpr fkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllyghrigpekidtl giygkvnihsigf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.92 Rfree 0.226
    Matthews' coefficent 2.28 Rfactor 0.186
    Waters 197 Solvent Content 46.11

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch