.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yvi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a death domain of human ankryn protein. To be Published
    Site RSGI
    PDB Id 2yvi Target Id hsk003001404.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12844, Molecular Weight 11677.55 Da.
    Residues 104 Isoelectric Point 4.82
    Sequence pgslsgteqaemkmavisehlglswaelarelqfsvedinrirvenpnslleqsvallnlwviregqna nmenlytalqsidrgeivnmlegsgrqsrnlkpdr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.92 Rfree 0.217
    Matthews' coefficent 1.87 Rfactor 0.198
    Waters 94 Solvent Content 34.05

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch