.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yvl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tRNA (m1A58) methyltransferase TrmI from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2yvl Target Id aae001000311.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12034, Molecular Weight 28651.98 Da.
    Residues 248 Isoelectric Point 9.08
    Sequence mnsfkegeyvlirfgekkflrkllpkqslsvkksvlkfdevigkpegvkingfevyrptleeiillgfe rktqiiypkdsfyialklnlnkekrvlefgtgsgallavlsevagevwtfeaveefyktaqknlkkfnl gknvkffnvdfkdaevpegifhaafvdvrepwhylekvhkslmegapvgfllptanqvikllesienyf gnlevveilhrhyktiserfrpedqmvahtaylvfgrklkt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.22964
    Matthews' coefficent 3.14 Rfactor 0.19376
    Waters 537 Solvent Content 60.88

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch