.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yvq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MGS domain of carbamoyl-phosphate synthetase from homo sapiens. To be Published
    Site RSGI
    PDB Id 2yvq Target Id hsk003000046.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12805, Molecular Weight 15873.33 Da.
    Residues 143 Isoelectric Point 9.82
    Sequence htaflkamlstgfkipqkgiligiqqsfrprflgvaeqlhnegfklfateatsdwlnannvpatpvawp sqegqnpslssirklirdgsidlvinlpnnntkfvhdnyvirrtavdsgiplltnfqvtklfaeavqks rkvds
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.98 Rfree 0.279
    Matthews' coefficent 2.35 Rfactor 0.232
    Waters 76 Solvent Content 47.55

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch