The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MS1043. To be Published
    Site RSGI
    PDB Id 2yvr Target Id ar_001000323.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12142, Molecular Weight 5937.34 Da.
    Residues 50 Isoelectric Point 5.68
    Sequence rdgertvycnvhkheplvlfcescdtltcrdcqlnahkdhqyqfledavr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.218
    Matthews' coefficent 2.01 Rfactor 0.187
    Waters 95 Solvent Content 38.68

    Ligand Information
    Metals ZN (ZINC) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch