.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yvt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of aq_1956. To be Published
    Site RSGI
    PDB Id 2yvt Target Id aae001001956.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12086, Molecular Weight 29928.11 Da.
    Residues 260 Isoelectric Point 6.39
    Sequence mgimprkvlaiknfkerfdllpklkgviaekqpdilvvvgnilknealekeyerahlarrepnrkvihe nehyiietldkffreigelgvktfvvpgkndaplkiflraayeaetaypnirvlhegfagwrgefevig fgglltehefeedfvlkyprwyveyilkfvnelkprrlvtifytppigefvdrtpedpkhhgsavvnti ikslnpevaivghvgkghelvgntivvnpgefeegryafldltqhkikleqfs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.20189
    Matthews' coefficent 2.31 Rfactor 0.16951
    Waters 333 Solvent Content 46.75

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch