.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yw2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of GAR synthetase from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2yw2 Target Id aae001000742.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12043, Molecular Weight 47427.14 Da.
    Residues 424 Isoelectric Point 5.93
    Sequence mkvlvvgnggrehaiawkvaqsplvkelyvakgnagiweiakrvdisptdveklaefaknegvdftivg peaplvegivdefekrglkifgpnkeaaklegskafaktfmkkygiptaryevftdfekakeyvekvga pivvkadglaagkgavvcetvekaietldrflnkkifgksservvieeflegeeasyivmingdryvpl ptsqdhkrlldedkgpntggmgaysptpvineevekrireeivervikglkeegiyyrgflyaglmitk egpkvlefnvrlgdpeaqpilmrvkndfletllnfyegkdvhikederyaldvvlasrgypekpetgki ihgldylksmedvvvfhagtkkegnftvtsggrvlnvcaygktlkeakerayeairyvcfegmhyrkdi gdkafkylse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.227
    Matthews' coefficent 2.44 Rfactor 0.203
    Waters 311 Solvent Content 49.53

    Ligand Information
    Ligands ATP (ADENOSINE-5'-TRIPHOSPHATE) x 2;PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch