.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ywa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2ywa Target Id ttk003001902.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14820, Molecular Weight 13932.26 Da.
    Residues 119 Isoelectric Point 5.33
    Sequence maslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraairgafqvgll pedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrleepa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.20 Rfree 0.243
    Matthews' coefficent 6.14 Rfactor 0.216
    Waters Solvent Content 79.97

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch