.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ywc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of GMP synthetase from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2ywc Target Id ttk003000113.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14227, Molecular Weight 55784.19 Da.
    Residues 503 Isoelectric Point 5.87
    Sequence mvlvldfgsqytrliarrlrelrafslilpgdapleevlkhrpqalilsggprsvfdpdaprpdprlfs sglpllgicygmqllaqelggrveragraeygkalltrhegplfrglegevqvwmshqdavtapppgwr vvaeteenpvaaiaspdgraygvqfhpevahtpkgmqilenflelagvkrdwtpehvleellrevrera gkdrvllavsggvdsstlalllakagvdhlavfvdhgllrlgereevegalralgvnllvvdakerflk alkgvedpeekrkiigrefvaafsqvarergpfrflaqgtlypdviesagghgaakikshhnvgglped lefellepfrllfkdevrelalllglpdtlrlrhpfpgpglavrvlgevteerleilrraddiftsllr erglyekvaqalavltpvrsvgvagderkygyvlalravttedfmtadwarlplefldeaarritrrvp eigrvvydltskppatiewe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.278
    Matthews' coefficent 2.91 Rfactor 0.236
    Waters 306 Solvent Content 57.71

    Ligand Information
    Ligands XMP (XANTHOSINE-5'-MONOPHOSPHATE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch