The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of GTP-binding protein LepA from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2ywg Target Id aae001001725.3
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12081, Molecular Weight 67653.65 Da.
    Residues 600 Isoelectric Point 6.13
    Sequence meqknvrnfciiahvdhgkstladrlleytgaiserekreqlldtldverergitvkmqavrmfykakd gntyklhlidtpghvdfsyevsralaacegalllidasqgieaqtvanfwkaveqdlviipvinkidlp sadvdrvkkqieevlgldpeeailasakegigieeileaivnripppkgdpqkplkalifdsyydpyrg avafvrifdgevkpgdkimlmstgkeyevtevgaqtpkmtkfdklsagdvgyiaasikdvrdirigdti thaknptkepvpgfqpakpmvyagiypaedttyeelrdalekyaindaaivyepesspalgmgfrvgfl gllhmeivqerlereygvkiittapnviyrvkkkftdevievrnpmdfpdnaglieyveepfvlvtiit pkeyvgpiiqlcqekrgiqknmtyldpntvyleyemplseiivdfhdkiksisrgfasydyefigyrps dlikltvlinkkpvdalsfivhadraqkfarrvaeklretiprqlfevhiqvakggkviaserikplra nvtakcyggdvtrkkkllenqkegkkrmkqfgkvqlpqeaflsvlkve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.94 Rfree 0.265
    Matthews' coefficent 2.13 Rfactor 0.205
    Waters 30 Solvent Content 42.23

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch