.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ywi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Geobacillus kaustophilus. to be published
    Site RSGI
    PDB Id 2ywi Target Id gka001001635.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12302, Molecular Weight 21820.65 Da.
    Residues 196 Isoelectric Point 4.94
    Sequence ghmeervlgmpavesnmfplgkqappfaltnvidgnvvrledvksdaatvimficnhcpfvkhvqhelv rlandympkgvsfvainsndaeqypedspenmkkvaeelgypfpylydetqevakaydaactpdfyifd rdlkcvyrgqlddsrpnngipvtgesiraaldallegrpvpekqkpsigcsikwkpsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.22
    Matthews' coefficent 2.33 Rfactor 0.198
    Waters 412 Solvent Content 47.12

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch