.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ywj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Methanocaldococcus jannaschii. to be published
    Site RSGI
    PDB Id 2ywj Target Id mja001001661.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13387, Molecular Weight 20596.02 Da.
    Residues 186 Isoelectric Point 6.20
    Sequence miigvlaiqgdveeheeaikkagyeakkvkrvedlegidaliipggestaigklmkkygllekiknsnl pilgtcagmvllskgtginqillelmditvkrnaygrqvdsfekeiefkdlgkvygvfirapvvdkils ddveviardgdkivgvkqgkymalsfhpelsedgykvykyfvencvkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.213
    Matthews' coefficent 1.93 Rfactor 0.183
    Waters 147 Solvent Content 36.26

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch