.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ywk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of RRM-domain derived from human putative RNA-binding protein 11. To be Published
    Site RSGI
    PDB Id 2ywk Target Id hsi002022581.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12551, Molecular Weight 9288.31 Da.
    Residues 82 Isoelectric Point 7.78
    Sequence mfpaqeeadrtvfvgnlearvreeilyelflqagpltkvtickdregkpksfgfvcfkhpesvsyaial lngirlygrpinv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.54 Rfree 0.214
    Matthews' coefficent 1.79 Rfactor 0.19
    Waters 80 Solvent Content 31.19

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch