.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ywn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of peroxiredoxin-like protein from Sulfolobus tokodaii. To be Published
    Site RSGI
    PDB Id 2ywn Target Id sto001001785.2
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14058, Molecular Weight 17790.77 Da.
    Residues 157 Isoelectric Point 8.44
    Sequence ghmveigelapdfelpdtelkkvklsalkgkvvvlafypaaftqvctkemctfrdsmakfnqvnavvlg isvdppfsnkafkehnklnftilsdynrevvkkynvawefpalpgyvlakravfvidkegkvrykwvsd dptkeppydeiekvvksls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.221
    Matthews' coefficent 2.37 Rfactor 0.2
    Waters 156 Solvent Content 48.11

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch