.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ywo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of reduced thioredoxin-like protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2ywo Target Id ttk003001681.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14776, Molecular Weight 21361.21 Da.
    Residues 188 Isoelectric Point 5.22
    Sequence mlqypelplesplidaelpdprggryrlsqfhepllavvfmcnhcpyvkgsigelvalaeryrgkvafv ginandyekypedapekmaafaeehgiffpylldetqevakayralrtpevflfderrllryhgrvndn pkdpskvqshdleaaieallrgeepplkeapaigctikwrpgnepevrig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.239
    Matthews' coefficent 3.06 Rfactor 0.215
    Waters 143 Solvent Content 59.78

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch