.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ywr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of GAR transformylase from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2ywr Target Id aae001000857.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12048, Molecular Weight 24145.02 Da.
    Residues 216 Isoelectric Point 8.36
    Sequence mlkigvlvsgrgsnlqaiidaiesgkvnasielvisdnpkayaierckkhnveckviqrkefpskkefe ermalelkkkgvelvvlagfmrilshnflkyfpnkvinihpslipafqglhaqkqavefgvkfsgctvh ivdesvdagpvivqavvpvlpeddentladrilkwehkilpqtvqwfaqdriiidgrkvivkdatygtl pvnpaleif
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.77 Rfree 0.219
    Matthews' coefficent 1.96 Rfactor 0.204
    Waters 266 Solvent Content 37.12

    Ligand Information
    Ligands
    Metals CO (COBALT) x 4;MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch